ACAP2 Antibody - C-terminal region : HRP

ACAP2 Antibody - C-terminal region : HRP
SKU
AVIARP54874_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACAP2 is a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAP2

Key Reference: N/A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: ARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Protein Size: 778

Purification: Affinity purified
More Information
SKU AVIARP54874_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54874_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23527
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×