ACOT11 Antibody - middle region : Biotin

ACOT11 Antibody - middle region : Biotin
SKU
AVIARP55280_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11

Molecular Weight: 65

Peptide Sequence: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-coenzyme A thioesterase 11

Protein Size: 594

Purification: Affinity Purified
More Information
SKU AVIARP55280_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55280_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26027
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×