ACRV1 Antibody - N-terminal region : Biotin

ACRV1 Antibody - N-terminal region : Biotin
SKU
AVIARP53590_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1

Key Reference: Reddi,P.P., J. Reprod. Immunol. 53 (1-2), 25-36 (2002)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acrosomal protein SP-10

Protein Size: 265

Purification: Affinity Purified
More Information
SKU AVIARP53590_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53590_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×