ACSBG2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACSBG2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Long-chain-fatty-acid--CoA ligase ACSBG2

Protein Size: 616

Purification: Affinity Purified

• SKU: AVIARP53793_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53793_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81616
• Host: Rabbit
• Conjugate: Conjugated, Biotin