ACTH (7-38) (human) (trifluoroacetate salt)

ACTH (7-38) (human) (trifluoroacetate salt)
SKU
CAY41547-10
Packaging Unit
10 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: 31-L-serine-a7-38-corticotropin (swine), trifluoroacetate salt

Amino Acids: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH

Purity: ≥95%

Formula Markup: C167H257N47O46 / XCF3COOH

Formula Weight: 3659.2

Notes: Adrenocorticotropic hormone (ACTH) (7-38) is a peptide fragment of ACTH (Item No. 24257) and an antagonist of melanocortin receptor 2 (MC2R), also known as the ACTH receptor.{67929} It inhibits ACTH-induced corticosterone production in isolated rat adrenal cells when used at concentrations of 0.455 or 4.55 µM. ACTH (7-38) also inhibits angiotensin-converting enzyme 1 (ACE1; IC50 = 750 nM for the dog enzyme).{45300} It inhibits basal cAMP secretion by isolated rat inner adrenocortical cells when used at a concentration of 1 µM.{67930} ACTH (7-38) induces hypotension in normotensive dogs (ED50 = 0.109 nmol/kg).{67931}
More Information
SKU CAY41547-10
Manufacturer Cayman Chemical
Manufacturer SKU 41547-10
Package Unit 10 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download