Anti-ADAMTS10

ADAM metallopeptidase with thrombospondin type 1 motif, 10, Polyclonal, IgG, Rabbit

Sequence: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK

GeneName: ADAMTS10

Ensembl Gene ID: ENSG00000142303

UniProt ID: Q9H324

Entrez Gene ID: 81794

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSRNOG00000008857: 94%, ENSMUSG00000024299: 91%

Enhanced Validation: No

• SKU: ATLHPA040223-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA040223-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 81794
• Host: Rabbit
• Conjugate: Unconjugated