Anti-ADAMTS3

ADAM metallopeptidase with thrombospondin type 1 motif, 3, Polyclonal, IgG, Rabbit

Sequence: QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL

GeneName: ADAMTS3

Ensembl Gene ID: ENSG00000156140

UniProt ID: O15072

Entrez Gene ID: 9508

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000043635: 82%, ENSRNOG00000027463: 84%

Enhanced Validation: No

• SKU: ATLHPA021369-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA021369-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 9508
• Host: Rabbit
• Conjugate: Unconjugated