ADAM2 Antibody - middle region : Biotin

ADAM2 Antibody - middle region : Biotin
SKU
AVIARP53589_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAM2

Key Reference: Eto,K., (2002) J. Biol. Chem. 277 (20), 17804-17810

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Size: 735

Purification: Affinity Purified
More Information
SKU AVIARP53589_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53589_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2515
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×