ADAM2 Antibody - N-terminal region : Biotin

ADAM2 Antibody - N-terminal region : Biotin
SKU
AVIARP53588_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Size: 735

Purification: Affinity Purified
More Information
SKU AVIARP53588_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53588_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2515
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×