ADAM2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Size: 735

Purification: Affinity Purified

• SKU: AVIARP53588_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53588_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2515
• Host: Rabbit
• Conjugate: Conjugated, FITC