ADAM7 Antibody - C-terminal region : Biotin

ADAM7 Antibody - C-terminal region : Biotin
SKU
AVIARP53618_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ADAM7

Key Reference: Seals,D.F. (2003) Genes Dev. 17 (1), 7-30

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 7

Protein Size: 754

Purification: Affinity Purified
More Information
SKU AVIARP53618_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53618_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8756
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×