ADAMDEC1 Antibody - middle region : Biotin

ADAMDEC1 Antibody - middle region : Biotin
SKU
AVIARP55070_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADAM DEC1

Protein Size: 470

Purification: Affinity Purified
More Information
SKU AVIARP55070_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55070_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27299
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×