ADO Antibody - C-terminal region : HRP

ADO Antibody - C-terminal region : HRP
SKU
AVIARP53811_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 [PubMed 17581819]).[supplied by OMIM, Mar 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AEDO

Key Reference: N/A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 2-aminoethanethiol dioxygenase

Protein Size: 270

Purification: Affinity purified
More Information
SKU AVIARP53811_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53811_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84890
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×