AFAP1 Antibody - N-terminal region : Biotin

AFAP1 Antibody - N-terminal region : Biotin
SKU
AVIARP57551_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a Src binding partner. It may represent a potential modulator of actin filament integrity in response to cellular signals, and may function as an adaptor protein by linking Src family members and/or other signaling proteins to actin filaments. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AFAP1

Key Reference: N/A

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: QWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 730

Purification: Affinity purified
More Information
SKU AVIARP57551_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57551_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60312
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×