AGTPBP1 Antibody - N-terminal region : FITC

AGTPBP1 Antibody - N-terminal region : FITC
SKU
AVIARP55205_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGTPBP1

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic carboxypeptidase 1

Protein Size: 1186

Purification: Affinity Purified
More Information
SKU AVIARP55205_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55205_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23287
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×