Ahi1 Antibody - C-terminal region : HRP

Ahi1 Antibody - C-terminal region : HRP
SKU
AVIARP56992_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe mental retardation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Jouberin

Protein Size: 1047

Purification: Affinity Purified
More Information
SKU AVIARP56992_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56992_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 308923
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×