Ak1 Antibody - middle region : Biotin

Ak1 Antibody - middle region : Biotin
SKU
AVIARP54830_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ak1 catalyzes the conversion of ATP and AMP to ADP in adenine nucleotide metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adenylate kinase isoenzyme 1

Protein Size: 194

Purification: Affinity Purified
More Information
SKU AVIARP54830_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54830_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24183
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×