AK3 Antibody - N-terminal region : FITC

AK3 Antibody - N-terminal region : FITC
SKU
AVIARP56872_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AK3

Key Reference: Jenkins,D., (2007) Am. J. Hum. Genet. 80 (6), 1162-1170

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP:AMP phosphotransferase, mitochondrial

Protein Size: 227

Purification: Affinity Purified
More Information
SKU AVIARP56872_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56872_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50808
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×