ALKBH3 Antibody - middle region : Biotin

ALKBH3 Antibody - middle region : Biotin
SKU
AVIARP55429_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1519 AB042029.1 2-1520

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALKBH3

Key Reference: Sundheim,O., (2006) EMBO J. 25 (14), 3389-3397

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3

Protein Size: 286

Purification: Affinity Purified
More Information
SKU AVIARP55429_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55429_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221120
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×