ALLC Antibody - N-terminal region : Biotin

ALLC Antibody - N-terminal region : Biotin
SKU
AVIARP57249_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP57249_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57249_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55821
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×