ALOX12 Antibody - C-terminal region : Biotin

ALOX12 Antibody - C-terminal region : Biotin
SKU
AVIARP54350_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALOX12

Key Reference: Guimaraes,P.E., (er) Spinal Cord (2008) In press

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arachidonate 12-lipoxygenase, 12S-type

Protein Size: 663

Purification: Affinity Purified
More Information
SKU AVIARP54350_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54350_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 239
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×