ALOX12 Antibody - C-terminal region : HRP

ALOX12 Antibody - C-terminal region : HRP
SKU
AVIARP54350_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALOX12

Key Reference: Guimaraes,P.E., (er) Spinal Cord (2008) In press

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arachidonate 12-lipoxygenase, 12S-type

Protein Size: 663

Purification: Affinity Purified
More Information
SKU AVIARP54350_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54350_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 239
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×