AMD1 Antibody - N-terminal region : FITC

AMD1 Antibody - N-terminal region : FITC
SKU
AVIARP54480_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1

Key Reference: Guidotti,A., (2007) Neuroreport 18 (1), 57-60

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-adenosylmethionine decarboxylase proenzyme

Protein Size: 186

Purification: Affinity Purified
More Information
SKU AVIARP54480_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54480_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 262
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×