AMELY Antibody - C-terminal region : FITC

AMELY Antibody - C-terminal region : FITC
SKU
AVIARP54565_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amelogenin, Y isoform

Protein Size: 192

Purification: Affinity Purified
More Information
SKU AVIARP54565_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54565_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 266
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×