AMIGO3 Antibody - N-terminal region : Biotin

AMIGO3 Antibody - N-terminal region : Biotin
SKU
AVIARP55919_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 3

Protein Size: 504

Purification: Affinity Purified
More Information
SKU AVIARP55919_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55919_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 386724
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×