AMIGO3 Antibody - N-terminal region : HRP

AMIGO3 Antibody - N-terminal region : HRP
SKU
AVIARP55919_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Amphoterin-induced protein 3

Protein Size: 504

Purification: Affinity Purified
More Information
SKU AVIARP55919_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55919_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 386724
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×