AMN1 Antibody - N-terminal region : Biotin

AMN1 Antibody - N-terminal region : Biotin
SKU
AVIARP54560_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMN1

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMN1 homolog

Protein Size: 258

Purification: Affinity Purified
More Information
SKU AVIARP54560_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54560_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 196394
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×