AMPH Antibody - N-terminal region : HRP

AMPH Antibody - N-terminal region : HRP
SKU
AVIARP55434_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH

Key Reference: Hou,T., (2008) J. Mol. Biol. 376 (4), 1201-1214

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Amphiphysin

Protein Size: 695

Purification: Affinity Purified
More Information
SKU AVIARP55434_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55434_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 273
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×