Amz2 Antibody - middle region : HRP

Amz2 Antibody - middle region : HRP
SKU
AVIARP56247_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Amz2 is Zinc metalloprotease. It exhibits activity against angiotensin-3 in vitro and does not hydrolyze neurogranin nor angiotensin-2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amz2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Archaemetzincin-2

Protein Size: 359

Purification: Affinity Purified
More Information
SKU AVIARP56247_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56247_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 360650
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×