ANKRD13D Antibody - middle region : Biotin

ANKRD13D Antibody - middle region : Biotin
SKU
AVIARP55995_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD13D

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 13D

Protein Size: 518

Purification: Affinity Purified
More Information
SKU AVIARP55995_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55995_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 338692
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×