Anti-ADAMTS2

ADAM metallopeptidase with thrombospondin type 1 motif 2, Polyclonal, IgG, Rabbit

Sequence: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV

GeneName: ADAMTS2

Ensembl Gene ID: ENSG00000087116

UniProt ID: O95450

Entrez Gene ID: 9509

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSRNOG00000061484: 83%, ENSMUSG00000036545: 79%

Enhanced Validation: No

• SKU: ATLHPA028363-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA028363-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 9509
• Host: Rabbit
• Conjugate: Unconjugated