Anti-ANKFN1

ankyrin repeat and fibronectin type III domain containing 1, Polyclonal, IgG, Rabbit

Sequence: RKPGKHPHHGGFSRHHRWLRIHSETQSLSLSEGIYTQHLSQACGLAQEPKEAKRAGPALDDPRGLTLAHAASLPEERNSSLQDARPSVRRLYVEPYA

GeneName: ANKFN1

Ensembl Gene ID: ENSG00000153930

UniProt ID: Q8N957

Entrez Gene ID: 162282

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSRNOG00000023532: 74%, ENSMUSG00000047773: 76%

Enhanced Validation: No

• SKU: ATLHPA048953-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA048953-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 162282
• Host: Rabbit
• Conjugate: Unconjugated