Anti-ApoA1 (D11-6)

Anti-ApoA1 [D11-6], Recombinant, IgG1 kappa, Human
SKU
ABAAb03979-10.0-BT
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: D11-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with human ApoA1.

Buffer Composition: PBS only.

Uniprot Accession No.: P02647

Specificity Statement: The antibody is specific for ApoA1. The antibody recognizes the epitope exposed by the ApoA1 protein on an HDL subclass significantly positively correlated with CHD, and the recognition epitope is determined on a polypeptide sequence comprising 41 amino acids (LGEEMRDRRAHVDALRTHLAPYSDELRQRLAARLEALKEN). The antibody does not react with HSA and the recombinant protein SAA1. Apolipoprotein A1 (ApoA1) is the main structural protein of high-density lipoprotein (HDL), and its physiological function is to help HDL capture free cholesterol.

Application Notes (Clone): The specificity of the antibody for ApoA1 protein was confirmed by ELISA analysis. The binding affinity of the antibody was 9.6×10^-10 M. The antibody was employed for detection of APOA1. The antibody could identify a possible pathogenic HDL subtype, and the detection result was positively correlated with CHD. Further, the detection results of the kit developed by the antibody had high consistency with the clinical diagnosis results (CN113265002A).
More Information
SKU ABAAb03979-10.0-BT
Manufacturer Absolute Antibody
Manufacturer SKU Ab03979-10.0-BT
Package Unit 1 mg
Quantity Unit STK
Reactivity Human
Clonality Recombinant
Application ELISA
Isotype IgG1 kappa
Host Human
Product information (PDF) Download
MSDS (PDF) Download