Anti-ASB16

ankyrin repeat and SOCS box containing 16, Polyclonal, IgG, Rabbit

Sequence: LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV

GeneName: ASB16

Ensembl Gene ID: ENSG00000161664

UniProt ID: Q96NS5

Entrez Gene ID: 92591

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000034768: 91%, ENSRNOG00000036794: 87%

Enhanced Validation: No

• SKU: ATLHPA066834-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA066834-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 92591
• Host: Rabbit
• Conjugate: Unconjugated