Anti-ASB18

ankyrin repeat and SOCS box containing 18, Polyclonal, IgG, Rabbit

Sequence: DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD

GeneName: ASB18

Ensembl Gene ID: ENSG00000182177

UniProt ID: Q6ZVZ8

Entrez Gene ID: 401036

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.6

Interspecies Mouse/Rat: ENSMUSG00000067081: 72%, ENSRNOG00000019557: 71%

Enhanced Validation: No

• SKU: ATLHPA068447-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA068447-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 401036
• Host: Rabbit
• Conjugate: Unconjugated