Anti-BSPRY

B-box and SPRY domain containing, Polyclonal, IgG, Rabbit

Sequence: VADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEI

GeneName: BSPRY

Ensembl Gene ID: ENSG00000119411

UniProt ID: Q5W0U4

Entrez Gene ID: 54836

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000028392: 82%, ENSRNOG00000015105: 75%

Enhanced Validation: No

• SKU: ATLHPA077485-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077485-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 54836
• Host: Rabbit
• Conjugate: Unconjugated