Anti-C1QTNF3

C1q and tumor necrosis factor related protein 3, Polyclonal, IgG, Rabbit

Sequence: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG

GeneName: C1QTNF3

Ensembl Gene ID: ENSG00000082196

UniProt ID: Q9BXJ4

Entrez Gene ID: 114899

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000058914: 94%, ENSRNOG00000018570: 73%

Enhanced Validation: No

• SKU: ATLHPA066011-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA066011-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 114899
• Host: Rabbit
• Conjugate: Unconjugated