Anti-CABLES1

Cdk5 and Abl enzyme substrate 1, Polyclonal, IgG, Rabbit

Sequence: SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN

GeneName: CABLES1

Ensembl Gene ID: ENSG00000134508

UniProt ID: Q8TDN4

Entrez Gene ID: 91768

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%

Enhanced Validation: No

• SKU: ATLHPA073649-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA073649-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 91768
• Host: Rabbit
• Conjugate: Unconjugated