Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Recombinant, IgG1 kappa, Human
SKU
ABAAb04219-10.0
Packaging Unit
100 μg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS with 0.02% Proclin 300.

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Uniprot Accession No.: P42574

Specificity Statement: The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.

Application Notes (Clone): The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A).
More Information
SKU ABAAb04219-10.0
Manufacturer Absolute Antibody
Manufacturer SKU Ab04219-10.0
Package Unit 100 μg
Quantity Unit STK
Reactivity Human
Clonality Recombinant
Application Western Blotting, ELISA, Inhibition
Isotype IgG1 kappa
Host Human
Product information (PDF) Download
MSDS (PDF) Download