Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG1, kappa, Host: Human

CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS with 0.02% Proclin 300.

Concentration: 1 mg/ml

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Uniprot Accession No.: P42574

• SKU: ABAAb04219-10.0
• Manufacturer: Absolute Antibody
• Manufacturer SKU: Ab04219-10.0
• Green Labware: No
• Package Unit: 100 μg
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Western Blotting, ELISA, Inhibition
• Isotype: IgG1
• Host: Human