Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG1, kappa, Host: Human

CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: P42574

• SKU: ABAAb04219-10.0-BT
• Manufacturer: Absolute Antibody
• Manufacturer SKU: Ab04219-10.0-BT
• Green Labware: No
• Package Unit: 1 mg
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Western Blotting, ELISA, Inhibition
• Isotype: IgG1
• Host: Human