Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG, kappa, Host: Rabbit
SKU
ABAAb04219-23.0-BT
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: P42574
More Information
SKU ABAAb04219-23.0-BT
Manufacturer Absolute Antibody
Manufacturer SKU Ab04219-23.0-BT
Green Labware No
Package Unit 1 mg
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Western Blotting, ELISA, Inhibition
Isotype IgG
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download