Anti-CFAP161

cilia and flagella associated protein 161, Polyclonal, IgG, Rabbit

Sequence: RIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEI

GeneName: CFAP161

Ensembl Gene ID: ENSG00000156206

UniProt ID: Q6P656

Entrez Gene ID: 161502

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000011154: 73%, ENSRNOG00000012301: 74%

Enhanced Validation: No

• SKU: ATLHPA076975-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076975-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 161502
• Host: Rabbit
• Conjugate: Unconjugated