Anti-Envelopment polyprotein (RV-Gn3)

Anti-Envelopment polyprotein [RV-Gn3], Recombinant, IgG kappa, Rabbit
SKU
ABAAb04482-23.0-BT
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: RV-Gn3

Antigen Long Description: The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.

Buffer Composition: PBS only.

Uniprot Accession No.: A2T080

Specificity Statement: This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.

Application Notes (Clone): The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).
More Information
SKU ABAAb04482-23.0-BT
Manufacturer Absolute Antibody
Manufacturer SKU Ab04482-23.0-BT
Package Unit 1 mg
Quantity Unit STK
Reactivity Virus
Clonality Recombinant
Application ELISA, Neutralization, Crystallography
Isotype IgG kappa
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download