Anti-FAM107B

family with sequence similarity 107 member B, Polyclonal, IgG, Rabbit

Sequence: LHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQ

GeneName: FAM107B

Ensembl Gene ID: ENSG00000065809

UniProt ID: Q9H098

Entrez Gene ID: 83641

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000026655: 99%, ENSRNOG00000014886: 99%

Enhanced Validation: No

• SKU: ATLHPA073195-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA073195-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 83641
• Host: Rabbit
• Conjugate: Unconjugated