Anti-FAM83D

family with sequence similarity 83 member D, Polyclonal, IgG, Rabbit

Sequence: ASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFS

GeneName: FAM83D

Ensembl Gene ID: ENSG00000101447

UniProt ID: Q9H4H8

Entrez Gene ID: 81610

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000027654: 61%, ENSRNOG00000015794: 64%

Enhanced Validation: No

• SKU: ATLHPA060854-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA060854-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 81610
• Host: Rabbit
• Conjugate: Unconjugated