Anti-FCER2

Fc fragment of IgE receptor II, Polyclonal, IgG, Rabbit

Sequence: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT

GeneName: FCER2

Ensembl Gene ID: ENSG00000104921

UniProt ID: P06734

Entrez Gene ID: 2208

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSRNOG00000001005: 59%, ENSMUSG00000005540: 56%

Enhanced Validation: Yes

• SKU: ATLHPA067430-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA067430-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 2208
• Host: Rabbit
• Conjugate: Unconjugated