Anti-GAREM2

GRB2 associated regulator of MAPK1 subtype 2, Polyclonal, IgG, Rabbit

Sequence: REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY

GeneName: GAREM2

Ensembl Gene ID: ENSG00000157833

UniProt ID: Q75VX8

Entrez Gene ID: 150946

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSRNOG00000048004: 99%, ENSMUSG00000044576: 99%

Enhanced Validation: No

• SKU: ATLHPA071575-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA071575-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 150946
• Host: Rabbit
• Conjugate: Unconjugated