Anti-HEY2

hes-related family bHLH transcription factor with YRPW motif 2, Polyclonal, IgG, Rabbit

Sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK

GeneName: HEY2

Ensembl Gene ID: ENSG00000135547

UniProt ID: Q9UBP5

Entrez Gene ID: 23493

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%

Enhanced Validation: No

• SKU: ATLHPA074851-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074851-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry, Chromatin Immunoprecipitation (ChIP), ChIP-Exo-Seq
• Isotype: IgG
• Human Gene ID: 23493
• Host: Rabbit
• Conjugate: Unconjugated