Anti-HEYL

hes related family bHLH transcription factor with YRPW motif-like, Polyclonal, IgG, Rabbit

Sequence: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII

GeneName: HEYL

Ensembl Gene ID: ENSG00000163909

UniProt ID: Q9NQ87

Entrez Gene ID: 26508

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.5

Interspecies Mouse/Rat: ENSRNOG00000015318: 86%, ENSMUSG00000032744: 86%

Enhanced Validation: No

• SKU: ATLHPA076960-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076960-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 26508
• Host: Rabbit
• Conjugate: Unconjugated