Anti-HPS5

HPS5, biogenesis of lysosomal organelles complex 2 subunit 2, Polyclonal, IgG, Rabbit

Sequence: NEESVDKTACECVRSPRESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHTLQQYSPEIL

GeneName: HPS5

Ensembl Gene ID: ENSG00000110756

UniProt ID: Q9UPZ3

Entrez Gene ID: 11234

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000014418: 54%, ENSRNOG00000055531: 55%

Enhanced Validation: No

• SKU: ATLHPA077851-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077851-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 11234
• Host: Rabbit
• Conjugate: Unconjugated